#HOT PRODUCT

[Bachem 한국공식대리점] PACAP-38

등록일2026. 01. 07
조회수131
링크 복사하기
[Bachem 한국공식대리점] PACAP-38

[Bachem 한국공식대리점] PACAP-38


어스바이오는 Bachem 한국 공식 대리점으로서 모든 제품을 전문적으로 취급 및 공급하고 있습니다.
Bachem의 PACAP-38 제품을 소개드립니다.
 

[PACAP-38 (human, mouse, ovine, porcine, rat)]

PACAP-38 (human, mouse, ovine, porcine, rat)


Product Description:

Kojro 등은 PAC1 작용제인 PACAP-27(H-1172)과 PACAP-38이 α-secretase의 활성을 강하게 증가시킨다는 것을 관찰했습니다. 이러한 APP 분해 효소의 상향 조절은 APP의 non-amyloidogenic processing를 촉진하여 Aβ40/42의 생성을 감소시키며, 그 결과 알츠하이머병 예방에 도움이 될 수 있습니다.

또한 APP[V717I] 형질전환 마우스에서 비강 투여된 PACAP-38은 somatostatin의 유도를 통해 Aβ-degrading enzyme인 neprilysin의 생성을 추가로 증가시키는 것으로 나타났습니다.
 

Additional Information:

  • Salt form: Trifluoroacetate
  • Molecular weight: 4534.32
  • Chemical Formula: C₂₀₃H₃₃₁N₆₃O₅₃S
  • Storage Temperature: < -15°C
  • Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat)
  • One Letter code: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
  • Source: Synthetic
  • Old Product Number: H-8430


Literature:

Effects of peptide HI on basal and stimulated insulin and glucagon secretion in the mouse.

B.Ahrén and J.Lundquist, Neuropeptides, 11, 159 (1988)


Pituitary adenylate cyclase-activating polypeptide and its receptors: from structure to functions.

D.Vaudry et al., Pharmacol. Rev., 52, 269 (2000)


Isolation of a novel 38 residue-hypothalamic polypeptide which stimulates adenylate cyclase in pituitary cells.

A.Miyata et al., Biochem. Biophys. Res. Commun., 164, 567 (1989)


PACAP--a multifacetted neuropeptide.

J.Fahrenkrug, Chronobiol. Int., 23, 53 (2006)


Neuropeptide pituitary adenylate cyclase-activating polypeptide (PACAP) slows down Alzheimer's disease-like pathology in amyloid precursor protein-transgenic mice.

D.Rat et al., FASEB J., 25, 3208 (2011)

 



어스바이오(USBIO)는 Bachem 한국 공식 대리점입니다.
해당 제품에 대한 문의나 Bachem 제품의 견적 또는 문의사항이 있으시면 아래로 연락주시기 바랍니다.
Tel : 02-862-2816 / email : bio@usbio.co.kr

관련 포스트